PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK28456.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 435aa    MW: 47792.7 Da    PI: 8.022
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK28456.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-172367147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+eE+++++da k++G g W+ I +++g ++t+ q++s+ qk+
        PK28456.1 23 REKWTEEEHQKFLDALKLYGRG-WRQIEEHVG-TKTAVQIRSHAQKF 67
                     789*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.14E-161770IPR009057Homeodomain-like
PROSITE profilePS5129421.2761872IPR017930Myb domain
TIGRFAMsTIGR015572.7E-162170IPR006447Myb domain, plants
SMARTSM007174.4E-132270IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-92363IPR009057Homeodomain-like
PfamPF002491.1E-142366IPR001005SANT/Myb domain
CDDcd001673.19E-112568No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MGLTEIYDSA PKARKPYTIT KQREKWTEEE HQKFLDALKL YGRGWRQIEE HVGTKTAVQI  60
RSHAQKFFSK VVRGSIGNVE GSVQPIAIPP PRPKKKPKHP YPRKSVDLFN LSILHQSERS  120
PSPSLVHTDK GVKSPTSVLS SHGSDAVGSA TSDQNNRSSS MSRTTDLHSI ILSPFEKNNG  180
HLLSKSSNEE KSSLPENQFS DCSTMENVLC LKCESGAKNT KHTEEETKLS TSTSFKIFGK  240
IVLLSDLEKG SPSGVEGSKT LQTDQMPVSE LSPDQLGTDL CLGGIVSDCH LLACGASINL  300
LEQQKEDSNA VKGNASMLQW SLYQTPCNYI IADNIPSVEQ TFLSSCAEGK TKDKEVQKER  360
SCTGSNEGSA SGIETLGDTN IEAVNSFSQE PPTKVSVEPC NSRKGFVPYK RCLAERDNVS  420
SMKPNDRERQ KIRVC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010099677.11e-166Myb-like protein G
TrEMBLW9RAU01e-166W9RAU0_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73133244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18330.12e-44MYB_related family protein